This is a working overview of Mass spectrometry, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-03-26 and is reviewed periodically as new material appears.
Once reconstituted, a peptide solution is generally less stable than the dry powder. Hydrolysis, oxidation, aggregation, and microbial growth can change the preparation over time, so storage temperature and duration are practical concerns. Dividing a solution into single-use aliquots before freezing can reduce repeated freeze-thaw cycles, which may otherwise cause precipitation or loss of activity. The optimal storage conditions vary by peptide, and no single rule applies to all sequences. Records of solvent, concentration, date, and storage history help maintain traceability. Studies often report stability under defined conditions rather than universal shelf lives.
Reconstitution is the process of dissolving a lyophilized peptide powder in a suitable liquid to produce a solution for laboratory or clinical use. The dry powder is typically a porous cake or fluffy solid formed by freeze-drying an aqueous or mixed-solvent preparation. Adding solvent restores the peptide to a dissolved state, but the result is not necessarily identical to the original pre-lyophilization solution. Factors such as pH, ionic strength, temperature, and the peptide's sequence influence how completely and quickly dissolution occurs. The term is distinct from dilution, which lowers concentration without changing the physical state of an already dissolved material.
Documentation supports reproducibility and traceability. Records often include lot number, solvent composition, final concentration, preparation date, and storage location. Such details help distinguish procedural variation from actual sample instability. Questions remain about how best to predict long-term stability from short-term accelerated studies, because peptide degradation pathways differ widely. For many peptides, the relationship between in vitro solution stability and biological behavior is incompletely understood and is an active area of research.
After reconstitution, a peptide solution is typically stored under conditions that limit degradation. Cool temperatures slow hydrolysis and oxidation, while freezing can preserve samples for longer periods. Repeated freeze-thaw cycles may promote aggregation or precipitation, so aliquoting before freezing is a common laboratory practice. The optimal storage temperature depends on the peptide sequence, buffer composition, and expected duration. Solutions containing oxidizable residues may benefit from inert gas overlays or antioxidants, though compatibility with the specific peptide must be considered.
| Property | Value | Notes |
|---|---|---|
| Physical state before reconstitution | Lyophilized powder or cake | Appearance varies from fluffy to compact; not a solution. |
| Common solvent | Sterile or ultrapure water | Many peptides dissolve, but solubility is sequence-dependent. |
| Alternative solvent | Dilute acetic acid or acetonitrile/water | Used for hydrophobic or basic peptides; compatibility varies. |
| Typical storage after reconstitution | 2–8 °C short term; −20 °C or below for aliquots | Stability is peptide-specific; avoid repeated freeze-thaw. |
| Common analytical method | Reverse-phase HPLC | Assesses purity and concentration; mass spectrometry confirms identity. |
Quality control of reconstituted peptides combines visual inspection with instrumental analysis. A clear solution does not prove correct identity or purity, and a cloudy solution does not always indicate failure. Reverse-phase high-performance liquid chromatography can separate the peptide from related impurities, while mass spectrometry confirms molecular mass and detects modifications. pH measurement and osmolality checks provide additional information about the solution environment, and documentation of lot number, solvent, and storage history supports traceability.
After a peptide is reconstituted, handling practices affect its chemical and physical stability over time. Aqueous solutions can support microbial growth unless they are prepared with aseptic technique or contain preservatives. Container material matters because peptides can adsorb to glass or plastic surfaces, reducing the amount available in solution. Repeated transfers increase exposure to air and potential contaminants, and temperature fluctuations can accelerate degradation. These factors are separate from the peptide's intrinsic sequence-based stability.
Storage conditions for reconstituted peptides are product-specific. Cool temperatures slow many degradation pathways, but freezing can concentrate solutes and promote aggregation. Light exposure can oxidize susceptible residues such as methionine, cysteine, or tryptophan. Oxygen in headspace can contribute to oxidation, while acidic or basic pH can drive hydrolysis and deamidation. The best storage condition for a given sequence is often determined empirically because general rules do not capture all sequence-specific effects.
The choice of solvent depends on the peptide's sequence, charge, and solubility profile. Water is common for hydrophilic peptides, while aqueous mixtures containing acetonitrile, methanol, or a small amount of acid may be needed for hydrophobic or basic sequences. Adding the liquid to the powder, rather than the reverse, can reduce clumping and improve wetting. Gentle mixing or brief vortexing may help, but vigorous agitation can create foam and shear sensitive structures. Complete dissolution is judged by a clear solution with no visible particles.
Buffer components and ionic strength affect how a peptide dissolves and remains in solution. Some sequences require a defined pH range to avoid precipitation or aggregation, while others tolerate pure water. The optimal conditions are often determined empirically because solubility cannot be predicted reliably from sequence alone. Even when a peptide dissolves, the resulting solution may contain aggregates that are not visible to the eye. Analytical methods such as reversed-phase high-performance liquid chromatography and mass spectrometry are used to confirm identity and purity after reconstitution.
Peptide reconstitution is the process of dissolving a dried peptide preparation in a liquid solvent to form a solution. Many peptides are supplied as lyophilized powders because removing water improves stability during shipping and storage. The dried material may appear as a cake, flake, or loose powder depending on the manufacturing and drying method. Reconstitution restores the peptide to a liquid state so that it can be further diluted, analyzed, or handled in laboratory workflows. The term is distinct from dilution, which lowers concentration after a solution already exists.
Microbial contamination is a concern for aqueous peptide solutions, especially those without preservatives. Bacteriostatic water contains an antimicrobial preservative and is used in some laboratory settings, while sterile water lacks preservatives. Filtration through a sterile filter can reduce particulates and microbes, but some peptides adsorb to filter membranes. The effect of preservatives on peptide stability is peptide-dependent and not fully predictable. Documentation of lot number, solvent, date, and storage conditions supports traceability and reproducibility.
After reconstitution, peptide solutions are generally less stable than lyophilized powders, and hydrolysis, oxidation, deamidation, and aggregation can occur in solution. Stability depends on peptide sequence, concentration, pH, buffer composition, temperature, light exposure, and dissolved oxygen. Many research protocols store reconstituted solutions at 4 °C for short periods or at -20 °C or -80 °C for longer periods. Repeated freeze-thaw cycles can promote aggregation and loss of activity. The optimal storage condition is peptide-specific and often determined empirically rather than predicted from sequence alone.
During reconstitution, solvent penetrates the powder, breaks interparticle contacts, and solvates polar and nonpolar groups. Gentle mixing or swirling can speed dissolution, while vigorous shaking may introduce foaming and surface denaturation. Aggregation becomes more likely when the peptide concentration exceeds its solubility or when the pH is near the isoelectric point. The link between a specific reconstitution method and long-term stability is not fully predictable from sequence alone. How excipients, container surfaces, and residual moisture influence aggregation remains an open question.
Lyophilization removes water from a peptide solution under vacuum, leaving a porous cake or a loose powder. The dry form often improves stability during shipping and storage because water-mediated degradation slows. Reconstitution reverses the process by adding a solvent so peptide molecules hydrate and enter solution. Complete dissolution depends on peptide sequence, purity, salt form, and any excipients present. Some lyophilized powders dissolve quickly, while others form haze, gels, or persistent particles.
Lectin affinity chromatography is a form of affinity chromatography where lectins are used to separate components within the sample. Lectins, such as concanavalin A are proteins which can bind specific alpha-D-mannose and alpha-D-glucose carbohydrate molecules. Some common carbohydrate molecules that is used in lectin affinity chromatography are Con A-Sepharose and WGA-agarose. Another example of a lectin is wheat germ agglutinin which binds D-N-acetyl-glucosamine. The most common application is to separate glycoproteins from non-glycosylated proteins, or one glycoform from another glycoform. Although there are various ways to perform lectin affinity chromatography, the goal is extract a sugar ligand of the desired protein.
Sampling provides one rational means of verification that a production lot conforms to the requirements of technical specifications. 100% inspection does not guarantee 100% compliance and is too time-consuming and costly. Rather than evaluating all items, a specified sample is taken, inspected or tested, and a decision is made about accepting or rejecting the entire production lot. Sampling plans have known risks: an acceptable quality limit (AQL) and a rejectable quality level, such as lot tolerance percent defective (LTDP), are part of the operating characteristic curve of the sampling plan. These are primarily statistical risks and do not necessarily imply that a defective product is intentionally being made or accepted. Plans can have a known average outgoing quality limit (AOQL). A single sampling plan for attributes is a statistical method by which the lot is accepted or rejected on the basis of one sample. Suppose that we have a lot of sizes M {\displaystyle M} ; a random sample of size N < M {\displaystyle N<M} is selected from the lot; and an acceptance number B
There is not enough evidence to support the routine use of tranexamic acid to prevent bleeding in people with blood cancers. However, several trials are currently assessing this use of tranexamic acid. For people with inherited bleeding disorders (e.g. von Willebrand's disease), tranexamic acid is often given. It has also been recommended for people with acquired bleeding disorders (e.g., directly acting oral anticoagulants (DOACs)) to treat serious bleeding. The use of tranexamic acid, applied directly to the area that is bleeding or taken by mouth, appears useful to treat nose bleeding compared to packing the nose with cotton pledgets alone. It decreases the risk of rebleeding within 10 days.
Some hormonal birth control methods utilize cervical drug delivery methods. The earliest example of such dates to 1850 Ancient Egypt when acadia gum was inserted into the vagina, releasing spermicidal components. Examples in the modern era include vaginal rings and intrauterine devices (IUDs) that release hormones into the reproductive system to prevent fertilization. Vaginal rings are plastic ring-shaped devices that are inserted into the vaginal canal and slowly release hormones such as estradiol or progestin. Hormonal IUDs are T-shaped devices inserted into the uterus, releasing progestin over extended periods of time. These hormones work to thicken the cervical mucus to prevent sperm from penetrating and reaching the fallopian tubes. Copper IUDs are another form of intrauterine devices that release copper ions instead of hormones. The copper ions are toxic to sperm and therefore prevents successful fertilization.
Weather observation quality control systems verify probability, history, and trends. One of the main and simplest forms of quality control is the check of probability. This check throws out impossible observations, such as the dew point being higher than the temperature or data outside acceptable ranges, such as temperatures over 200 degrees Fahrenheit. Another basic quality control check is to have the data compared to preset geographic extremes, perhaps combined with diurnal variations. However this only flags the data as uncertain because the station could be reporting correctly but there is no way to know. A better way is to correlate with previous observations as well as the other simple checks. This method uses one hour persistence to check the quality of the current observation. This method makes continuity of observations better since the system is able to make better judgments on whether the current observations are bad or not.
Sources: en.wikipedia.org
Bacteria in the genus Pseudomonas are able to aerobically grow on L-carnitine, as it is the bacteria's sole source of nitrogen and carbon. The L-carnitine is metabolized at its beta-hydroxy group by L-carnitine-3-dehydrogenase and the coenzyme NAD+, which forms 3-dehydrocarnitine; the 3-dehydrocarnitine then acts as an inducer for the enzyme, further allowing the enzyme to catalyze the reaction. The formed 3-dehydrocarnitine may also be broken down to form glycine betaine which is then metabolized through step demethylation to form glycine. Carnitine Carnitine dehydrogenase Enzyme Metabolism Pseudomonas
In 2013, during the Long Shutdown 1, three ISOLDE buildings were demolished. They've been built again as a new single building with a new control room, a data storage room, three laser laboratories, a biology and materials laboratory, and a room for visitors. Another building extension for the MEDICIS project and several others equipped with electrical, cooling and ventilation systems to be used for the HIE-ISOLDE project in the future were also built. In addition, the robots which were installed for the handling of radioactive targets have been replaced with more modern robots. In 2015, for the first time, a radioactive isotope beam could be accelerated to an energy level of 4.3 MeV per nucleon in the ISOLDE facility thanks to the HIE-ISOLDE upgrades. In late 2017, the CERN-MEDICIS facility produced its first radioisotopes and by the end of 2020 had provided external nine hospitals and research facilities with 41 batches of radioisotopes. Phase 2 of the facility's HIE-ISOLDE upgrade was completed in 2018, which allows ISOLDE to accelerate radioactive beams up to 10 MeV per nucleon.
The 1993 film Jurassic Park (based on the 1990 Michael Crichton novel of the same name) features dinosaurs that were genetically altered so that they could not produce the amino acid lysine. This was known as the "lysine contingency" and was supposed to prevent the cloned dinosaurs from surviving outside the park, forcing them to be dependent on lysine supplements provided by the park's veterinary staff. In reality, no animals are capable of producing lysine (it is an essential amino acid). Autotroph Bradytroph "Regulation of endosomal clathrin and retromer-mediated endosome to Golgi retrograde transport by the J-domain protein RME-8" - The EMBO Journal "Pleiotropic effects of purine auxotrophy inRhizobium meliloti on cell surface molecules" - Springerlink "Auxotrophy and Organic Compounds in the Nutrition of Marine Phytoplankton"
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
"Chelating agents are organic compounds which are capable of linking to metal ions". They are usually useful for removing toxic heavy metal ions from body. Dimercaprol is a common chelating agent to treat toxic exposure to arsenic, mercury, gold, and lead. It is in the chelating class of drugs. From Figure 3, the SH-ligands of dimercaprol can compete with -SH groups in natural enzymes for heavy metal, forming a stable metal complex to be excreted through urine. The action antagonises the toxic metal ions and helps remove them from body circulation. However, dimercaprol has a narrow TI and is later replaced by its derivative, 2,3-dimercaptosuccinic acid (DMSA). Neutralising antibodies block pathogen entry into cells to prevent further infection and replication. Infliximab is a monoclonal antibody binding with tumour necrosis factor-alpha (TNF-alpha), inhibiting its pro-inflammatory action. Its efficacious anti-inflammatory action is clinically used in Crohn's Disease, active rheumatoid arthritis, psoriatic arthritis, and active ankylosing spondylitis.
Sources: en.wikipedia.org
The standard botanical author abbreviation Tswett is applied to plants that he described. Ostrowski, W (1968). "Michael S. Tswett—inventor of column chromatography (On the occasion of 65th anniversary of his lecture on the column chromatography technique)". Folia Biol. (Krakow). Vol. 16, no. 4. pp. 429–48. PMID 4885242. R. Willstätter, A. Stoll, Untersuchungen über Chlorophyll, Springer, Berlin (1913) Biography of Mikhail S. Tsvet (pdf, in German) Mikhail S. Tsvet: Physical chemical studies on chlorophyll adsorptions Berichte der Deutschen botanischen Gesellschaft 24, 316–323 (1906)
Intussusceptive angiogenesis, also known as splitting angiogenesis, is the formation of a new blood vessel by splitting an existing blood vessel into two. Intussusception was first observed in neonatal rats. In this type of vessel formation, the capillary wall extends into the lumen to split a single vessel in two. There are four phases of intussusceptive angiogenesis. First, the two opposing capillary walls establish a zone of contact. Second, the endothelial cell junctions are reorganized and the vessel bilayer is perforated to allow growth factors and cells to penetrate into the lumen. Third, a core is formed between the 2 new vessels at the zone of contact that is filled with pericytes and myofibroblasts. These cells begin laying collagen fibers into the core to provide an extracellular matrix for growth of the vessel lumen. Finally, the core is fleshed out with no alterations to the basic structure. Intussusception is important because it is a reorganization of existing cells. It allows a vast increase in the number of capillaries without a corresponding increase in the number of endothelial cells. This is especially important in embryonic development as there are not enough resources to create a rich microvasculature with new cells every time a new vessel develops.
A 2016 paper describes the efforts of how ansuvimab was originally developed as part of research efforts led by Dr. Nancy Sullivan at the United States National Institutes of Health Vaccine Research Center and Dr. J. J. Muyembe-Tamfum from the Institut National de Recherche Biomedicale (INRB) in the Democratic Republic of Congo. This collaborative effort also involved researchers from Institute of Biomedical Research and the United States Army Medical Research Institute of Infectious Diseases. A survivor from the 1995 outbreak of Ebola virus disease in Kikwit, Democratic Republic of Congo donated blood to the project that began roughly ten years after they had recovered. Memory B cells isolated from the survivor's blood were immortalized, cultured and screened for their ability to produce monoclonal antibodies that reacted with the glycoprotein of Ebola virus. Ansuvimab was identified from one of these cultures and the antibody heavy and light chain gene sequences were sequenced from the cells. These sequences were then cloned into recombinant DNA plasmids and purified antibody protein for initial studies was produced in cells derived from HEK 293 cells.
The structure of CARD11 involves multiple domains that impact the protein's ability to activate BCL10 and NF-κB activity. CARD11 has a CARD domain, a serine-threonine rich region, is associated with the N-terminus, which is essential for NF-κB signaling activity. The region following the CARD domain is highly coiled. In deleting the CARD domain, all NF-κB signaling activity was prevented. The CARD domain on CARD11 interacts with the CARD domain on BCL10 to initiate the signaling pathway. On the C-terminus of CARD11 there is the MAGUK domain that is associated with the cell membrane. This domain is often referred to as the inhibitory domain. Protein kinase C activates CARD11 by phosphorylating serine residues within the inhibitory domain. CARD11 has been shown to interact with BCL10. This interaction occurs between the CARD domain on BCL10 and the CARD domain on CARD11, and results in signal propagation and NF-κB activation. Human CARD11 genome location and CARD11 gene details page in the UCSC Genome Browser.
Sources: en.wikipedia.org
It means adding liquid to a lyophilized peptide powder so it dissolves into solution. The dry powder is not a finished liquid product, and the resulting concentration depends on the volume added. Complete dissolution should be visually confirmed before use.
Some peptides have hydrophobic regions or strong charge interactions that make water a poor solvent alone. A small amount of organic solvent, acid, or base may be needed before aqueous dilution. The appropriate approach depends on sequence and should be based on documented compatibility.
No. Solutions can degrade through hydrolysis, oxidation, aggregation, and microbial growth, and stability varies widely by peptide. Storage at reduced temperature and avoidance of repeated freeze-thaw cycles are common laboratory practices. Specific shelf lives are determined by stability testing, not by a general rule.
Short-term storage is often at refrigerated temperatures, while longer storage may use freezing. Repeated freeze-thaw cycles are generally avoided because they can promote aggregation. Container material and headspace can also affect stability.