The short version of Photo-oxidation fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-11-22 and is reviewed periodically as new material appears.
Peptide reconstitution refers to dissolving a dried peptide preparation in a liquid to form a solution. The dried form is often produced by lyophilization, a process that removes water under vacuum from a frozen sample. This yields a porous cake or powder that is more stable for transport and storage than many liquid formulations. The term reconstitution is also often used for other dried biological materials, so context matters greatly.
The choice of liquid depends on peptide sequence, counterion content, and intended analysis. Water is sufficient for many hydrophilic peptides, while hydrophobic sequences may need a small amount of organic solvent or a buffer. pH can affect charge, solubility, and stability, so the target value is usually selected for the specific peptide. Exact laboratory protocols vary by supplier and application, and no single solvent reliably works for every different peptide.
Reconstitution involves considerably more than simply adding liquid. The solid must wet completely, and gentle mixing should avoid foaming, which can denature some peptides. Insoluble particles may indicate incomplete dissolution, aggregation, or insoluble excipients. The resulting concentration is calculated from the weighed peptide mass and the final volume, not from the volume of liquid added alone. Because peptides can adsorb to surfaces, container material and transfer steps can influence recovery, especially at low concentrations.
Once a peptide is in solution, its stability depends on temperature, pH, ionic strength, and the presence of oxygen or light. Many peptides are less stable in liquid form than as dry powders because hydrolysis, oxidation, and aggregation can proceed faster in water. Storage at low temperature slows these reactions but does not eliminate them. Some sequences are particularly sensitive to repeated freezing and thawing, which can cause precipitation or conformational changes. The container material and headspace also influence adsorption and surface-induced aggregation.
Practical handling often includes dividing a reconstituted solution into single-use aliquots to limit freeze-thaw cycling. Vials made of low-binding plastic or glass with inert closures are common, and some protocols add a carrier protein or bulking agent to reduce adsorption. Filtration through a sterile filter may be used when a sterile solution is required, but filters can retain peptide if binding occurs. Mixing is usually gentle; vigorous vortexing can introduce air-liquid interfaces that promote aggregation. Each of these steps involves trade-offs between sterility, recovery, and analytical accuracy.
| Property | Value | Notes |
|---|---|---|
| Physical form | Lyophilized powder or cake | Appearance varies with fill and drying cycle |
| Common solvent | Sterile water or buffer | Buffer choice depends on peptide and assay |
| Solubility class | Variable; often water-soluble | Hydrophobic sequences may need co-solvent |
| Typical pH range | Peptide-dependent | Charge and stability can change with pH |
| Storage before use | 2–8 °C, desiccated | Follow supplier label; protect from moisture |
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
2023 Analytical Scientist the Power List - Leaders and Advocates 2020 Society for Glycobiology Molecular and Cellular Proteomics (MCP) / American Society for Biochemistry and Molecular Biology (ASBMB) Lectureship Award 2019 inaugural winner of the US Human Proteome Organization Lifetime Achievement in Proteomics Award 2019 Analytical Scientist the Power List 2017 American Society for Mass Spectrometry John B. Fenn Award for a Distinguished Contribution in Mass Spectrometry 2016 American Association for the Advancement of Science Fellow 2015 Human Proteome Organization Distinguished Service Award 2015 German Mass Spectrometry Society (Deutsche Gesellschaft für Massenspektrometrie, DGMS) Wolfgang Paul Lecture 2013 Boston University The William Fairfield Warren Distinguished Professorship 2011 American Chemical Society Fellow 2010 American Chemical Society Frank H. Field and Joe L. Franklin Award for Outstanding Achievement in Mass Spectrometry 2009 International Mass Spectrometry Foundation Thomson Medal 2008 Human Proteome Organization Discovery in Proteomic Sciences Award
The vaginal environment is slightly acidic, with pH ranging from 3.8 - 4.5 based on multiple factors such as age, natural bacteria, and stage of menstrual cycle. Due to the variety in possible pH values, this poses an interesting consideration for drug delivery. Absorption and release of drugs is often influenced by pH, so if the pH is changing through the menstrual cycle, different combinations could be needed at different times to achieve the most effective drug delivery system.
Sources: en.wikipedia.org
Individual transmembrane adenylyl cyclase isoforms have been linked to numerous physiological functions. Soluble adenylyl cyclase (sAC, AC10) has a critical role in sperm motility. Adenylyl cyclase has been implicated in memory formation, functioning as a coincidence detector. AC-IV was first reported in the bacterium Aeromonas hydrophila, and the structure of the AC-IV from Yersinia pestis has been reported. These are the smallest of the AC enzyme classes; the AC-IV (CyaB) from Yersinia is a dimer of 19 kDa subunits with no known regulatory components (PDB: 2FJT). AC-IV forms a superfamily with mammalian thiamine-triphosphatase called CYTH (CyaB, thiamine triphosphatase). These forms of AC have been reported in specific bacteria (Prevotella ruminicola O68902 and Rhizobium etli Q8KY20, respectively) and have not been extensively characterized. There are a few extra members (~400 in Pfam) known to be in class VI. Class VI enzymes possess a catalytic core similar to the one in Class III.
Corin, also called atrial natriuretic peptide-converting enzyme, is a protein that in humans is encoded by the CORIN gene. Human corin, a polypeptide of 1042 amino acids, consists of an N-terminal cytoplasmic domain, a transmembrane domain and an extracellular region with two frizzled-like domains, eight LDL receptor-like domains, a scavenger receptor-like domain and a C-terminal trypsin-like serine protease domain. Corin is synthesized as a zymogen that is activated by PCSK6. Corin exhibits a trypsin-like catalytic activity favoring basic residues at the P1 position. Human corin contains 19 N-glycosylation sites. N-glycans promote corin expression on the cell surface and protect corin from metalloproteinase-mediated shedding.
No chromosome translocations, chimeric genes, or fusion proteins have been described in BIA-ALCL although the neoplastic cells in the disease have been described to have gene copy number variations involving gains in gene copies on the p arm of chromosome 19 and losses of gene copies in the p arms of chromosome 10 and 1. The neoplastic cells in BIA-ALCL show mutations of the STAT3 gene in 64% of cases and reports of mutations in JAK1, JAK3, DNMT3A, and TP53 genes. The development of BIA-ALCL, it has often been suggested, may be at least in part a T-cell-induced, inflammation-driven cancer response to the implant.
Sources: en.wikipedia.org
It is the process of dissolving a dried peptide preparation in a suitable liquid to obtain a solution. The liquid is often water, a buffer, or a water-organic mixture. The procedure is common in laboratory research and analytical work.
Drying reduces water content and can limit chemical degradation during shipping and storage. Lyophilized peptides are typically more stable than solutions at similar temperatures. The dried form also allows a defined mass to be weighed before liquid is added.
No. Hydrophilic peptides often dissolve readily in water, but hydrophobic or aggregated sequences may require buffer, pH adjustment, or organic co-solvent. Solubility depends on sequence, counterions, and purity. A trial in a small volume can reveal whether a chosen liquid is suitable.
Storage time depends on peptide sequence, concentration, solvent, and temperature. No single shelf life applies to all peptides. Stability should be determined by analytical testing for the specific preparation.